PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG013447.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 285aa    MW: 31439.6 Da    PI: 7.0222
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG013447.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.34.6e-4271061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfa vhk+FGasnv kll++l+  +reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+ql+++l  +k
  CCG013447.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFASVHKVFGASNVAKLLNELNAAQREDAVNSLAYEAEERLRDPVYGCVGLISILQHRLKQLQNDLYCAK 104
                  7********************************************************************************************99988 PP

       DUF260  99 ee 100
                  +e
  CCG013447.1 105 KE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4556107IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-427103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFASVH KVFGASNVAK LLNELNAAQR  60
EDAVNSLAYE AEERLRDPVY GCVGLISILQ HRLKQLQNDL YCAKKELANY IGPQAMLPMV  120
MQTQHMGNPS SSTVMQHSVM PMMGIPSVGQ MGMRAEAHQH QNHHVHPQQL YEAQQLAAVV  180
AAREQEILRA YEQQHHQQEI VRFNGGLEPA NSVAATGYHQ INPSAAAAAM PPSLALGTFD  240
NTFQIQTQGE PHPNQLQAQV LLQPQQIQQH PKSESEEGRS GGPSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039214.10.0PREDICTED: LOB domain-containing protein 36 isoform X1
RefseqXP_011039215.10.0PREDICTED: LOB domain-containing protein 36 isoform X1
SwissprotQ9FKZ33e-85LBD36_ARATH; LOB domain-containing protein 36
TrEMBLB9HE740.0B9HE74_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11460.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-84ASYMMETRIC LEAVES 2-like 1